IDEAS home Printed from https://ideas.repec.org/a/nat/nature/v393y1998i6683d10.1038_30782.html
   My bibliography  Save this article

Correction: A caspase-activated DNase that degrades DNA during apoptosis, and its inhibitor ICAD

Author

Listed:
  • Masato Enari
  • Hideki Sakahira
  • Hideki Yokoyama
  • Katsuya Okawa
  • Akihiro Iwamatsu
  • Shigekazu Nagata

Abstract

Nature 391, 43–50 (1998) We have noticed that the sequence of murine CAD (Fig. 5d) carries an error. The sequence of the amino acids from 47 to 76 should read SRLCLYEDGTEVTDDCFPGLPNDAELLLL, instead of FPAVPVRRWHGGDGRLLPGPFPTTLSSYCF as published. The open reading frame of the cDNA (pEF-mCAD) consistsof 344 amino acids instead of 345 amino acids, and the mature murine CAD is a protein of 342 amino acids with a calculated relative molecular mass of 39,214.18.

Suggested Citation

  • Masato Enari & Hideki Sakahira & Hideki Yokoyama & Katsuya Okawa & Akihiro Iwamatsu & Shigekazu Nagata, 1998. "Correction: A caspase-activated DNase that degrades DNA during apoptosis, and its inhibitor ICAD," Nature, Nature, vol. 393(6683), pages 396-396, May.
    • Handle: RePEc:nat:nature:v:393:y:1998:i:6683:d:10.1038_30782
    DOI: 10.1038/30782
    as

    Download full text from publisher

    File URL: https://www.nature.com/articles/30782
    File Function: Abstract
    Download Restriction: Access to the full text of the articles in this series is restricted.
    File URL: https://libkey.io/10.1038/30782?utm_source=ideas
    LibKey link: if access is restricted and if your library uses this service, LibKey will redirect you to where you can use your library subscription to access this item
    ---><---

    As the access to this document is restricted, you may want to search for a different version of it.

    More about this item

    Statistics

    Access and download statistics

    Corrections

    All material on this site has been provided by the respective publishers and authors. You can help correct errors and omissions. When requesting a correction, please mention this item's handle: RePEc:nat:nature:v:393:y:1998:i:6683:d:10.1038_30782. See general information about how to correct material in RePEc.

    If you have authored this item and are not yet registered with RePEc, we encourage you to do it here. This allows to link your profile to this item. It also allows you to accept potential citations to this item that we are uncertain about.

    We have no bibliographic references for this item. You can help adding them by using this form .

    If you know of missing items citing this one, you can help us creating those links by adding the relevant references in the same way as above, for each refering item. If you are a registered author of this item, you may also want to check the "citations" tab in your RePEc Author Service profile, as there may be some citations waiting for confirmation.

    For technical questions regarding this item, or to correct its authors, title, abstract, bibliographic or download information, contact: Sonal Shukla or Springer Nature Abstracting and Indexing (email available below). General contact details of provider: http://www.nature.com .

    Please note that corrections may take a couple of weeks to filter through the various RePEc services.

    IDEAS is a RePEc service. RePEc uses bibliographic data supplied by the respective publishers.